HPA024549

SPATA32 antibody from Sigma-Aldrich
AEP2, C17orf46, FLJ25414, TEX34, VAD1.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024549
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024549, RRID:AB_1845589
Product name
Anti-C17orf46 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024549
Antibody type
Polyclonal
Antigen
Uncharacterized protein C17orf46 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVHSNMGLPTPQTFRPWSLNSNCRSFTEENHVSAC
HHSISAQTSKHLFWANKLIQASEHSLQRAINMQLN
NGSAGQPIRSPL
Storage
-20C
Provider Type Product Number
- No reagents -