ABIN182615

GRM6 antibody from antibodies-online
CSNB1B, GPRC1F, mGlu6, MGLUR6

Antibody data

Product number
ABIN182615
Provider
antibodies-online
Product name
anti-Glutamate Receptor, Metabotropic 6 (GRM6) antibody
Provider product page
antibodies-online - ABIN182615
Antibody type
Polyclonal
Antigen
The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the C terminal of human GRM6
Reactivity
Human, Mouse, Rat, Canine, Chicken/Avian, Rabbit
Host
Rabbit
Antigen sequence
ITFSLTSLQVVGMIAWLGARPPHSVIDYEEQRTVD
PEQAR GVLKCDMSDL
Vial size
50 µg
Provider Type Product Number
- No reagents -