Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182615 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glutamate Receptor, Metabotropic 6 (GRM6) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the C terminal of human GRM6
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Rabbit
- Host
- Rabbit
- Antigen sequence
ITFSLTSLQVVGMIAWLGARPPHSVIDYEEQRTVD
PEQAR GVLKCDMSDL- Vial size
- 50 µg
Submitted references The whole nucleotide sequence and chromosomal localization of the gene for human metabotropic glutamate receptor subtype 6.
Hashimoto T, Inazawa J, Okamoto N, Tagawa Y, Bessho Y, Honda Y, Nakanishi S
The European journal of neuroscience 1997 Jun;9(6):1226-35
The European journal of neuroscience 1997 Jun;9(6):1226-35
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-GRM6 Antibody Titration: 0.2-1 μg/mL Positive Control: Human brain
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: GRM6 Sample Tissue: HepG2 Whole Cell lysates Antibody Dilution: 1.0 μg/mL