H00007586-B01P

ZKSCAN1 antibody from Abnova Corporation
KOX18, PHZ-37, ZNF139, ZNF36, ZSCAN33

Antibody data

Product number
H00007586-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007586-B01P, RRID:AB_1582093
Product name
ZKSCAN1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00007586-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZKSCAN1 protein.
Antigen sequence
MMTAESREATGLSPQAAQEKDGIVIAKVEEEDEED
HMWGQDSTLQDTPPPDPEIFRQRFRRFCYQNTFGP
REALSRLKELCHQWLRPEINTKEQILELLVLEQFL
SILPKELQVWLQEYRPDSGEEAVTLLEDLELDLSG
QQVPGQVHGPEMLARGMVPLDPVQESSSFDLHHEA
TQSHFKHSSRKPRLLQSRALPAAHIPAPPHEGSPR
DQAMASALFTADSQAMVKIEDMAVSLILEEWGCQN
LARRNLSRDNRQENYGSAFPQGGENRNENEESTSK
AETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQ
QKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREK
GKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKC
FTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIH
SGEKPYECNECGKAFSQSSDLTKHQRIHTGEKPYE
CSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKA
FTRSSTLTLHHRIHARERASEYSPASLDAFGAFLK
SCV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -