HPA024444

SPPL2C antibody from MilliporeSigma / Merck KGaA
IMP5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024444
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA024444, RRID:AB_1851764
Product name
Anti-AC003662.3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024444
Antibody type
Polyclonal
Antigen
Signal peptide peptidase-like 2C Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HTKGWLAQGQGAHGLLIVSRVSDQQCSDTTLAPQD
PRQPLADLTIPVAMLHYADMLDILSHTRGEAVVRV
AMYAPPEPIID
Storage
-20C
Provider Type Product Number
- No reagents -