HPA006806

PAX4 antibody from Sigma-Aldrich
MODY9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006806
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006806, RRID:AB_1079570
Product name
Anti-PAX4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006806
Antibody type
Polyclonal
Antigen
paired box gene 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RIAQLKGECPALFAWEIQRQLCAEGLCTQDKTPSV
SSINRVLRALQEDQGLPCTRLRSPAVLAPAVLTPH
SGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQR
GQYPDSVARGKLATATSL
Storage
-20C
Provider Type Product Number
- No reagents -