HPA007182

PAX4 antibody from MilliporeSigma / Merck KGaA
MODY9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007182
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007182, RRID:AB_1079571
Product name
Anti-PAX4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007182
Antibody type
Polyclonal
Antigen
paired box gene 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQEKLKWEMQLPGASQGLTVPRVAPGIISAQQSPG
SVPTAALPALEPLGPSCYQLCWATAPERCLSDTPP
KACLKPCWGHLPPQPNSLDSGLLCLPCPSSHCHLA
SLSGSQALLWPGCPLLYGLE
Storage
-20C
Provider Type Product Number
- No reagents -