HPA015325

CDK17 antibody from Sigma-Aldrich
PCTAIRE2, PCTK2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015325
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015325, RRID:AB_1855090
Product name
Anti-PCTK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015325
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase PCTAIRE-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNE
PIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHS
VIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESD
QASGTSSDEVQSPTGVCLRNRI
Storage
-20C
Provider Type Product Number
- No reagents -