Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182424 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-C-Myc Binding Protein (MYCBP) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MYCBP antibody: synthetic peptide directed towards the middle region of human MYCBP
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
AATPENPEIELLRLELAEMKEKYEAIVEENKKLKA
KLAQY EPPQEEKRAE- Vial size
- 50 µg
Submitted references The application of microarray technology to the analysis of the cancer genome.
AMY-1 interacts with S-AKAP84 and AKAP95 in the cytoplasm and the nucleus, respectively, and inhibits cAMP-dependent protein kinase activity by preventing binding of its catalytic subunit to A-kinase-anchoring protein (AKAP) complex.
Cowell JK, Hawthorn L
Current molecular medicine 2007 Feb;7(1):103-20
Current molecular medicine 2007 Feb;7(1):103-20
AMY-1 interacts with S-AKAP84 and AKAP95 in the cytoplasm and the nucleus, respectively, and inhibits cAMP-dependent protein kinase activity by preventing binding of its catalytic subunit to A-kinase-anchoring protein (AKAP) complex.
Furusawa M, Taira T, Iguchi-Ariga SM, Ariga H
The Journal of biological chemistry 2002 Dec 27;277(52):50885-92
The Journal of biological chemistry 2002 Dec 27;277(52):50885-92
No comments: Submit comment
No validations: Submit validation data