Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404749 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-POU Class 6 Homeobox 2 (POU6F2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-POU6F2 antibody: synthetic peptide directed towards the N terminal of human POU6F2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
MSALLQDPMIAGQVSKPLLSVRSEMNAELRGEDKA
ATSDS ELNEPLLAPV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Germline mutations of the POU6F2 gene in Wilms tumors with loss of heterozygosity on chromosome 7p14.
Perotti D, De Vecchi G, Testi MA, Lualdi E, Modena P, Mondini P, Ravagnani F, Collini P, Di Renzo F, Spreafico F, Terenziani M, Sozzi G, Fossati-Bellani F, Radice P
Human mutation 2004 Nov;24(5):400-7
Human mutation 2004 Nov;24(5):400-7
No comments: Submit comment
No validations: Submit validation data