Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008699 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008699, RRID:AB_1079664
- Product name
- Anti-POU6F2
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLF
GARGNPALSDPGTPDQHQASQTHPPFPVGPQPLLT
AQQLASAVAGVMPGGPPALNQPILIPFNMAGQLGG
QQGLVLTLPTANLTNIQGLVAAAAAGGIMTLPLQN
LQAT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Spinal V1 inhibitory interneuron clades differ in birthdate, projections to motoneurons, and heterogeneity
Origin and Segmental Diversity of Spinal Inhibitory Interneurons
Worthy A, Anderson J, Lane A, Gomez-Perez L, Wang A, Griffith R, Rivard A, Bikoff J, Alvarez F
eLife 2024;13
eLife 2024;13
Origin and Segmental Diversity of Spinal Inhibitory Interneurons
Sweeney L, Bikoff J, Gabitto M, Brenner-Morton S, Baek M, Yang J, Tabak E, Dasen J, Kintner C, Jessell T
Neuron 2018;97(2):341-355.e3
Neuron 2018;97(2):341-355.e3
No comments: Submit comment
No validations: Submit validation data