HPA008699

POU6F2 antibody from Sigma-Aldrich
RPF-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008699
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008699, RRID:AB_1079664
Product name
Anti-POU6F2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008699
Antibody type
Polyclonal
Antigen
POU domain, class 6, transcription factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLF
GARGNPALSDPGTPDQHQASQTHPPFPVGPQPLLT
AQQLASAVAGVMPGGPPALNQPILIPFNMAGQLGG
QQGLVLTLPTANLTNIQGLVAAAAAGGIMTLPLQN
LQAT
Storage
-20C
Provider Type Product Number
- No reagents -