Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487003 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Suppressor of Fused Homolog (Drosophila) (SUFUH) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SUFU antibody: synthetic peptide directed towards the middle region of human SUFU
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
NGQGILELLRTVPIAGGPWLITDMRRGETIFEIDP
HLQER VDKGIETDGS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references MicroRNA-378 promotes cell survival, tumor growth, and angiogenesis by targeting SuFu and Fus-1 expression.
Lee DY, Deng Z, Wang CH, Yang BB
Proceedings of the National Academy of Sciences of the United States of America 2007 Dec 18;104(51):20350-5
Proceedings of the National Academy of Sciences of the United States of America 2007 Dec 18;104(51):20350-5
No comments: Submit comment
No validations: Submit validation data