HPA008700

SUFU antibody from Sigma-Aldrich
PRO1280, SUFUH, SUFUXL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008700
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008700, RRID:AB_1080125
Product name
Anti-SUFU antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008700
Antibody type
Polyclonal
Antigen
Suppressor of fused homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEELHSAQQWNGQGILELLRTVPIAGGPWLITDMR
RGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCA
WDDLSRPPEDDEDSRSICIGTQPRRLSGKDTEQIR
ETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRK
DSLESDSSTA
Storage
-20C
Provider Type Product Number
- No reagents -