H00007773-M

ZNF230 antibody from Abnova Corporation
FDZF2
No application information provided.

Antibody data

Product number
H00007773-M
Provider
Abnova Corporation
Product name
ZNF230 mouse monoclonal antibody (hybridoma)
Provider product page
Abnova Corporation - H00007773-M
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ZNF230.
Antigen sequence
MTTFKEAVTFKDVAVFFTEEELGLLDPAQRKLYQD
VMLENFTNLLSVGHQPFHPFHFLREEKFWMMETAT
QREGNSGGKTIAEAGPHEDCPCQQIWEQTASDLTQ
SQDSIINNSHFFEQGDVPSQVEAGLSIIHTGQKPS
QNGKCKQSFSDVAIFDPPQQFHSGEKSHTCNECGK
SFCYISALRIHQRVHLREKLSKCDMRGKEFSQSSC
LQTRERVHTGEKPFKCEQCGKGFRCRAILQVHCKL
HTGEKPYICEKCGRAFIHDFQLQKHQIIHTGEKPF
KCEICGKSFCLRSSLNRHCMVHTAEKLYKSEECGK
GFTDSLDLHKHQIIHTGQKPYNCKECGKSFRWSSY
LLIHQRIHSGEKPYRCEECGKGYISKSGLNLHQRV
HTGERPYNCKECGKSFSRASSILNHKKLHCRKKPF
KCEDCGKRLVHRSFCKDQQGDHNGENSSKCEDCGK
RYKRRLNLDIILSLFLNDM
Provider Type Product Number
- No reagents -