AV35795

ZNF230 antibody from Sigma-Aldrich
FDZF2
No application information provided.

Antibody data

Product number
AV35795
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV35795, RRID:AB_1859143
Product name
Anti-ZNF230 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV35795
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF230 with an internal ID of P07047
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KCKQSFSDVAIFDPPQQFHSGEKSHTCNECGKSFC
YISALRIHQRVHLRE
Storage
-20C
Provider Type Product Number
- No reagents -