AV35871

ZNF230 antibody from Sigma-Aldrich
FDZF2
No application information provided.

Antibody data

Product number
AV35871
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV35871, RRID:AB_1848049
Product name
Anti-ZNF225 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV35871
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF225 with an internal ID of P07125
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
QDDMPCQVDAGLSIIHVKTETSEGRTCKKSFSDVS
VLDLHQQLQSREKSH
Storage
-20C
Provider Type Product Number
- No reagents -