Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007343-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007343-M01, RRID:AB_607269
- Product name
- UBTF monoclonal antibody (M01), clone 6B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UBTF.
- Antigen sequence
PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSN
GELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAE
EQQKQYKVHLDLWVKSLSPQDRAAYKEYIS- Isotype
- IgG
- Antibody clone number
- 6B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The maternal nucleolus plays a key role in centromere satellite maintenance during the oocyte to embryo transition.
Role of ooplasm in nuclear and nucleolar remodeling of intergeneric somatic cell nuclear transfer embryos during the first cell cycle.
Nuclear and nucleolar reprogramming during the first cell cycle in bovine nuclear transfer embryos.
Nucleologenesis and embryonic genome activation are defective in interspecies cloned embryos between bovine ooplasm and rhesus monkey somatic cells.
Fulka H, Langerova A
Development (Cambridge, England) 2014 Apr;141(8):1694-704
Development (Cambridge, England) 2014 Apr;141(8):1694-704
Role of ooplasm in nuclear and nucleolar remodeling of intergeneric somatic cell nuclear transfer embryos during the first cell cycle.
Østrup O, Strejcek F, Petrovicova I, Lucas-Hahn A, Morovic M, Lemme E, Petersen B, Laurincikova N, Niemann H, Laurincik J, Hyttel P
Cellular reprogramming 2011 Apr;13(2):145-55
Cellular reprogramming 2011 Apr;13(2):145-55
Nuclear and nucleolar reprogramming during the first cell cycle in bovine nuclear transfer embryos.
Østrup O, Petrovicova I, Strejcek F, Morovic M, Lucas-Hahn A, Lemme E, Petersen B, Niemann H, Laurincik J, Maddox-Hyttel P
Cloning and stem cells 2009 Sep;11(3):367-75
Cloning and stem cells 2009 Sep;11(3):367-75
Nucleologenesis and embryonic genome activation are defective in interspecies cloned embryos between bovine ooplasm and rhesus monkey somatic cells.
Song BS, Lee SH, Kim SU, Kim JS, Park JS, Kim CH, Chang KT, Han YM, Lee KK, Lee DS, Koo DB
BMC developmental biology 2009 Jul 28;9:44
BMC developmental biology 2009 Jul 28;9:44
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UBTF monoclonal antibody (M01), clone 6B6 Western Blot analysis of UBTF expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UBTF is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to UBTF on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to UBTF on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol