HPA006385

UBTF antibody from Atlas Antibodies
NOR-90, UBF, UBF1, UBF2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA006385
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006385, RRID:AB_888692
Product name
Anti-UBTF
Provider product page
Atlas Antibodies - HPA006385
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLP
EEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGK
GGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESE
LTRLLARMWNDLSEKKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -