HPA006385
UBTF antibody from Atlas Antibodies
NOR-90, UBF, UBF1, UBF2
Validated within the Antibodypedia Validation Initative
Antibody data
- Product number
- HPA006385
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006385, RRID:AB_888692
- Product name
- Anti-UBTF
- Provider product page
- Atlas Antibodies - HPA006385
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLP
EEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGK
GGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESE
LTRLLARMWNDLSEKKK
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line MOLT-4.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cerebral cortex tissue.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
Enhanced validation
- Submitted by
-
55af80e3e0991
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Confocal images of immunofluorescently stained human U-2 OS cells.The protein UBTF is shown in green and the microtubules in red. The image to the left show cells transfected with control siRNA and the image to the right show cells where UBTF has been downregulated with specific siRNA.
- Sample type
- U-2 OS cells
- Primary Ab dilution
- 1:72
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:800
- Knockdown/Genetic Approaches Application
- Immunocytochemistry
- KD Reagent Type
- siRNA
- Downregulation
- >75%
- KD Reagent Provider
- Thermo Fisher Scientific
- KD Reagent Prod no
- s14614
- KD Reagent Prod page
- KD Reagent Prod page
- KD Reagent Prod no 2
- s14613
- KD Reagent Page 2
- KD Reagent Page 2
- KD Reagent Prod no 3
- s14615
- KD Reagent Page 3
- KD Reagent Page 3
- Antibody Lot Number
- R04521
- Appendix
- 55b0d903c39d9.pdf
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong nuclear positivity in epidermal cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse retrosplenial granular cortex shows nuclear neuronal positivity.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows nuclear positivity.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse motor cortex shows nuclear positivity in neurons.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse thalamus shows nuclear immunoreactivity in anterodorsal thalamic nucleus neurons.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows nuclear and cytoplasmic immunoreactivity in neurons.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows nuclear immunoreactivity in neurons.
Supportive data in Antibodypedia
Enhanced validation
