HPA006385
UBTF antibody from Atlas Antibodies
NOR-90, UBF, UBF1, UBF2
Validated within the Antibodypedia Validation Initative
Antibody data
- Product number
- HPA006385
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006385, RRID:AB_1080447
- Product name
- Anti-UBTF
- Provider product page
- Atlas Antibodies - HPA006385
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLP
EEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGK
GGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESE
LTRLLARMWNDLSEKKK
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line MOLT-4.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in mouse cerebral cortex tissue.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image

- Experimental details
- Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-UBTF antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
55af80e3e0991
- Enhanced method
- Genetic validation
- Main image

- Experimental details
- Confocal images of immunofluorescently stained human U-2 OS cells.The protein UBTF is shown in green and the microtubules in red. The image to the left show cells transfected with control siRNA and the image to the right show cells where UBTF has been downregulated with specific siRNA.
- Sample type
- U-2 OS cells
- Primary Ab dilution
- 1:72
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:800
- Knockdown/Genetic Approaches Application
- Immunocytochemistry
- KD Reagent Type
- siRNA
- Downregulation
- >75%
- KD Reagent Provider
- Thermo Fisher Scientific
- KD Reagent Prod no
- s14614
- KD Reagent Prod page
- KD Reagent Prod page
- KD Reagent Prod no 2
- s14613
- KD Reagent Page 2
- KD Reagent Page 2
- KD Reagent Prod no 3
- s14615
- KD Reagent Page 3
- KD Reagent Page 3
- Antibody Lot Number
- R04521
- Appendix
- 55b0d903c39d9.pdf
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skin shows strong nuclear positivity in epidermal cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescence staining of mouse retrosplenial granular cortex shows nuclear neuronal positivity.
- Sample type
- MOUSE
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows nuclear positivity.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescence staining of mouse motor cortex shows nuclear positivity in neurons.
- Sample type
- MOUSE
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescence staining of mouse thalamus shows nuclear immunoreactivity in anterodorsal thalamic nucleus neurons.
- Sample type
- MOUSE
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows nuclear and cytoplasmic immunoreactivity in neurons.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human hippocampus shows nuclear immunoreactivity in neurons.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescence staining of mouse brain shows strong nuclear positivity in neurons in the cerebral cortex.
- Sample type
- MOUSE
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human tonsil shows strong nuclear positivity in non-germinal center cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescence staining of mouse basal forebrain shows moderate nuclear positivity in neurons in the caudate putamen.
- Sample type
- MOUSE
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescence staining of mouse brain shows strong positivity in neurons in the CA1 and granular cell layers in the hippocampus.
- Sample type
- MOUSE
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skin shows strong nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN