HPA006385

UBTF antibody from Atlas Antibodies
NOR-90, UBF, UBF1, UBF2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA006385
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006385, RRID:AB_1080447
Product name
Anti-UBTF
Provider product page
Atlas Antibodies - HPA006385
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLP
EEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGK
GGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESE
LTRLLARMWNDLSEKKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -