HPA006385

UBTF antibody from Sigma-Aldrich
NOR-90, UBF, UBF1, UBF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006385
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006385, RRID:AB_1080447
Product name
Anti-UBTF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006385
Antibody type
Polyclonal
Antigen
Nucleolar transcription factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLP
EEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGK
GGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESE
LTRLLARMWNDLSEKKK
Storage
-20C
Provider Type Product Number
- No reagents -