ABIN633236

antibody from antibodies-online

Targeting: HNRNPH1 hnRNPH, HNRPH1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN633236 - Provider product page
Provider: antibodies-online
Product name: anti-Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

HNRNPH1 protein structure - ABIN633236 shown in red.