Antibody data

Product number
H00001297-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001297-M07, RRID:AB_1574064
Product name
COL9A1 monoclonal antibody (M07), clone 3H1
Provider product page
Abnova Corporation - H00001297-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant COL9A1.
Antigen sequence
MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPVNS
NSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAAS
RRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPS
GLPEEYSFLTTFRMTGSTLKKNWNIWQIQDSSGKE
QVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLSSL
FDSQWHKIMIGVERSSATLFVDCNRIESLPIKPRG
PIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPL
RPRRETCHELPARITPSQTTDERGPPGEQGPPGPP
GPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKPGA
PGKPGTPGADTSP
Isotype
IgG
Antibody clone number
3H1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -