Antibody data

Product number
PAB20233
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20233, RRID:AB_10967954
Product name
C14orf119 polyclonal antibody
Provider product page
Abnova Corporation - PAB20233
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C14orf119.
Antigen sequence
SLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANW
SGPQRERFLEDLVAKAVPEKLQPLLDSLEQLSVSG
ADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLE
FSEPDFVAKFYQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -