Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003638 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003638, RRID:AB_2243669
- Product name
- Anti-C14orf119
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANW
SGPQRERFLEDLVAKAVPEKLQPLLDSLEQLSVSG
ADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLE
FSEPDFVAKFYQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Contribution of Antibody-based Protein Profiling to the Human Chromosome-centric Proteome Project (C-HPP)
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Fagerberg L, Oksvold P, Skogs M, Älgenäs C, Lundberg E, Pontén F, Sivertsson Å, Odeberg J, Klevebring D, Kampf C, Asplund A, Sjöstedt E, Al-Khalili Szigyarto C, Edqvist P, Olsson I, Rydberg U, Hudson P, Ottosson Takanen J, Berling H, Björling L, Tegel H, Rockberg J, Nilsson P, Navani S, Jirström K, Mulder J, Schwenk J, Zwahlen M, Hober S, Forsberg M, von Feilitzen K, Uhlén M
Journal of Proteome Research 2013 June;12(6):2439-2448
Journal of Proteome Research 2013 June;12(6):2439-2448
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012 April;75(7):2236-2251
Journal of Proteomics 2012 April;75(7):2236-2251
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and C14orf119 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413438).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
- Sample type
- HUMAN