H00010553-M04

HTATIP2 antibody from Abnova Corporation
CC3, FLJ26963, SDR44U1, TIP30

Antibody data

Product number
H00010553-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010553-M04, RRID:AB_1237743
Product name
HTATIP2 monoclonal antibody (M04), clone 3E11
Provider product page
Abnova Corporation - H00010553-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant HTATIP2.
Antigen sequence
MAETEALSKLREDFRMQNKSVFILGASGETGRVLL
KEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVV
DFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFV
RVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN
FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQ
ESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAM
LNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
Isotype
IgG
Antibody clone number
3E11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -