Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182667 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-HIV-1 Tat Interactive Protein 2, 30kDa (HTATIP2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HTATIP2 antibody: synthetic peptide directed towards the N terminal of human HTATIP2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FRMQNKSVFILGASGETGRVLLKEILEQGLFSKVT
LIGRR KLTFDEEAYK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references TIP30 interacts with an estrogen receptor alpha-interacting coactivator CIA and regulates c-myc transcription.
Jiang C, Ito M, Piening V, Bruck K, Roeder RG, Xiao H
The Journal of biological chemistry 2004 Jun 25;279(26):27781-9
The Journal of biological chemistry 2004 Jun 25;279(26):27781-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting