HPA024321

HTATIP2 antibody from Sigma-Aldrich
CC3, FLJ26963, SDR44U1, TIP30
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024321
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024321, RRID:AB_1851288
Product name
Anti-HTATIP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024321
Antibody type
Polyclonal
Antigen
Oxidoreductase HTATIP2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGA
DKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVL
LCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVT
VVRAMLNNVVRPRDKQMELLENKAIHDLGK
Storage
-20C
Provider Type Product Number
- No reagents -