HPA020975

ZNF233 antibody from Atlas Antibodies
FLJ38032
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020975
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020975, RRID:AB_1859145
Product name
Anti-ZNF233
Provider product page
Atlas Antibodies - HPA020975
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GKGIGYSSGLPRHQCFHIGEKCYRNGDSGEGFSQG
SHLQPHQRVSTGENLYRCQVYARSSNQNSCLPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -