HPA020975

ZNF233 antibody from MilliporeSigma / Merck KGaA
FLJ38032
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020975
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020975, RRID:AB_1859145
Product name
Anti-ZNF233 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020975
Antibody type
Polyclonal
Antigen
Zinc finger protein 233 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKGIGYSSGLPRHQCFHIGEKCYRNGDSGEGFSQG
SHLQPHQRVSTGENLYRCQVYARSSNQNSCLPS
Storage
-20C
Provider Type Product Number
- No reagents -