Antibody data

Product number
ABIN405390
Provider
antibodies-online
Product name
anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405390
Antibody type
Polyclonal
Antigen
The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the middle region of human WNT9B
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Canine
Host
Rabbit
Antigen sequence
CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFL
GSKRG NKDLRARADA
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -