Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405390 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the middle region of human WNT9B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFL
GSKRG NKDLRARADA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Variation in WNT genes is associated with non-syndromic cleft lip with or without cleft palate.
Chiquet BT, Blanton SH, Burt A, Ma D, Stal S, Mulliken JB, Hecht JT
Human molecular genetics 2008 Jul 15;17(14):2212-8
Human molecular genetics 2008 Jul 15;17(14):2212-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting