Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503300 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Endonuclease G (ENDOG) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ENDOG antibody: synthetic peptide directed towards the middle region of human ENDOG
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPN
ILARA GSLKAITAGS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Bioinformatic and image analyses of the cellular localization of the apoptotic proteins endonuclease G, AIF, and AMID during apoptosis in human cells.
Varecha M, Amrichová J, Zimmermann M, Ulman V, Lukásová E, Kozubek M
Apoptosis : an international journal on programmed cell death 2007 Jul;12(7):1155-71
Apoptosis : an international journal on programmed cell death 2007 Jul;12(7):1155-71
No comments: Submit comment
No validations: Submit validation data