HPA021335

ENDOG antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021335
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021335, RRID:AB_1848151
Product name
Anti-ENDOG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021335
Antibody type
Polyclonal
Antigen
Endonuclease G, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVIGKNHVAVPTHFFKVLILEAAGGQIELRTYVMP
NAPVDEAIPLERFLVPIESIERASGLLFVPNILAR
AGSLKAITAGSK
Storage
-20C
Provider Type Product Number
- No reagents -