HPA006227

HCFC2 antibody from Sigma-Aldrich
HCF-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006227
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006227, RRID:AB_1079042
Product name
Anti-HCFC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006227
Antibody type
Polyclonal
Antigen
Host cell factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APSQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTD
LPYQAASSDSSAAPNMQGVRMDPHRQGSNNIVPNS
INDTINSTKTEQPATKETSMKNKPDFKALTDSNAI
LYPSLASNASNHNSHVVDMLRKNEGPHTSANVGV
Storage
-20C
Provider Type Product Number
- No reagents -