HPA023856

ZNF112 antibody from Sigma-Aldrich
ZFP112, ZNF228
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023856
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023856, RRID:AB_1859018
Product name
Anti-ZFP112 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023856
Antibody type
Polyclonal
Antigen
Zinc finger protein 112 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EREEKLLMVETETPRDGCSGRKNQQKMESIQEVTV
SYFSPKELSSRQTWQQSAGGLIRCQDFLKVFQGKN
SQLQEQGNSLGQVWAGIPVQISEDKNYIFTHIGNG
SNYIKSQGYPSWRAHHSWRKMYLKESHNYQCRCQQ
I
Storage
-20C
Provider Type Product Number
- No reagents -