HPA022990

SPOUT1 antibody from Atlas Antibodies
C9orf114, CENP-32, HSPC109
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022990
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022990, RRID:AB_2732428
Product name
Anti-SPOUT1
Provider product page
Atlas Antibodies - HPA022990
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEES
EFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLE
PGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAG
LYWGYTVRLASC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -