HPA021656

SLC10A3 antibody from Sigma-Aldrich
DXS253E, P3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021656
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021656, RRID:AB_1856955
Product name
Anti-SLC10A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021656
Antibody type
Polyclonal
Antigen
P3 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSEGIIVISSQYPGQANRTAPGPMLRVTSLDTEVL
TIKNVSAITWGGGGGFVVSIHSGLAGLAPLHIQLV
DAHEAPPTLIEERRDFCIKVSPAEDTPATLSADLA
HFSENPILYLLLPLIFVNKCSFGCKVELEVLKGLM
Q
Storage
-20C
Provider Type Product Number
- No reagents -