HPA008701

RING1 antibody from Sigma-Aldrich
RNF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008701
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008701, RRID:AB_1079814
Product name
Anti-RING1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008701
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase RING1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TRYVKTTGNATVDHLSKYLALRIALERRQQQEAGE
PGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPAL
PSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVN
EKFWKVS
Storage
-20C
Provider Type Product Number
- No reagents -