HPA021323

GCC1 antibody from Atlas Antibodies
FLJ22035, GCC1P, GCC88, MGC20706
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021323
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021323, RRID:AB_1849554
Product name
Anti-GCC1
Provider product page
Atlas Antibodies - HPA021323
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDPADTSSSDSLTQALQLAAANEPTFFLYAEQLAR
KEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHRE
EVAALQSHIEKNIRDQSREGANLEYLKNIIYRFLT
LPDSLGRQQTLTAILTILHFSPEEKQVIMRLPT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -