H00079571-B01P

GCC1 antibody from Abnova Corporation
FLJ22035, GCC1P, GCC88, MGC20706

Antibody data

Product number
H00079571-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079571-B01P, RRID:AB_10840397
Product name
GCC1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00079571-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human GCC1 protein.
Antigen sequence
MEKFGMNFGGGPSKKDLLETIETQKKQLLQYQARL
KDVVRAYKSLLKEKEALEASIKVLSVSHEADVGLA
GVQLPGLTFPDSVDDRCSTHSEDSTGTATSLDTAA
SLTSTKGEFGVEDDRPARGPPPPKSEEASWSESGV
SSSSGDGPFAGGEVDKRLHQLKTQLATLTSSLATV
TQEKSRMEASYLADKKKMKQDLEDASNKAEEERAR
LEGELKGLQEQIAETKARLITQQHDRAQEQSDHAL
MLRELQKLLQEERTQRQDLELRLEETREALAGRAY
AAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQ
PDPRLQELQEEAARLKSHFQAQLQQEMRKTALAED
QLRQQSQVEEQRVAALENQISEVSELLGTYEKAKQ
KDQLAIQKLKERILQLDLENKTLALAASSRSPLDS
HGEESSLDVNVLKDKMEKLKRLLQVAARKSQVTLD
VEKLCDLEIMPSSEAADGEKATALYYQQELKQLKE
EFERYKMRAQVVLKSKNTKDGNLGKELEAAQEQLA
ELKEKYISLRLSCEELEHQHQQEADDWKQELARLQ
QLHRQELERCQLDFRDRTLKLEEELHKQRDRALAV
LTEKDLELEQLRSVALASGLPGRRSPVGGGGPGDP
ADTSSSDSLTQALQLAAANEPTFFLYAEQLARKEV
EITSLRKQKHRLEVEVHQLQDRLLEEGERHREEVA
ALQSHIEKNIRDQSREGANLEYLKNIIYRFLTLPD
SLGRQQTLTAILTILHFSPEEKQVIMRLPTSASWW
PSGKR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -