HPA021323

GCC1 antibody from Sigma-Aldrich
FLJ22035, GCC1P, GCC88, MGC20706
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021323
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021323, RRID:AB_1849554
Product name
Anti-GCC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021323
Antibody type
Polyclonal
Antigen
GRIP and coiled-coil domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDPADTSSSDSLTQALQLAAANEPTFFLYAEQLAR
KEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHRE
EVAALQSHIEKNIRDQSREGANLEYLKNIIYRFLT
LPDSLGRQQTLTAILTILHFSPEEKQVIMRLPT
Storage
-20C
Provider Type Product Number
- No reagents -