HPA006499

PFDN1 antibody from Sigma-Aldrich
PFD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006499
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006499, RRID:AB_1079596
Product name
Anti-PFDN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006499
Antibody type
Polyclonal
Antigen
Prefoldin subunit 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDT
EIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQ
KIAEEKIKELEQKKSYLERSVKEAEDNIREMLMAR
RA
Storage
-20C
Provider Type Product Number
- No reagents -