Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA016811 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-LRRC8A
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ICLPCKWVTKDSCNDSFRGWAAPGPEPTYPNSTIL
PTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFA
K- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Activation of osmo-sensitive LRRC8 anion channels in macrophages is important for micro-crystallin joint inflammation
Ca2+ Dependence of Volume-Regulated VRAC/LRRC8 and TMEM16A Cl– Channels
Bestrophin 1 is indispensable for volume regulation in human retinal pigment epithelium cells
SWELL1, a Plasma Membrane Protein, Is an Essential Component of Volume-Regulated Anion Channel
Chirayath T, Ollivier M, Kayatekin M, Rubera I, Pham C, Friard J, Linck N, Hirbec H, Combes C, Zarka M, Lioté F, Richette P, Rassendren F, Compan V, Duranton C, Ea H
Nature Communications 2024;15(1)
Nature Communications 2024;15(1)
Ca2+ Dependence of Volume-Regulated VRAC/LRRC8 and TMEM16A Cl– Channels
Centeio R, Ousingsawat J, Schreiber R, Kunzelmann K
Frontiers in Cell and Developmental Biology 2020;8
Frontiers in Cell and Developmental Biology 2020;8
Bestrophin 1 is indispensable for volume regulation in human retinal pigment epithelium cells
Milenkovic A, Brandl C, Milenkovic V, Jendryke T, Sirianant L, Wanitchakool P, Zimmermann S, Reiff C, Horling F, Schrewe H, Schreiber R, Kunzelmann K, Wetzel C, Weber B
Proceedings of the National Academy of Sciences 2015;112(20)
Proceedings of the National Academy of Sciences 2015;112(20)
SWELL1, a Plasma Membrane Protein, Is an Essential Component of Volume-Regulated Anion Channel
Qiu Z, Dubin A, Mathur J, Tu B, Reddy K, Miraglia L, Reinhardt J, Orth A, Patapoutian A
Cell 2014;157(2):447-458
Cell 2014;157(2):447-458
No comments: Submit comment
No validations: Submit validation data