HPA005809

PRDM2 antibody from Atlas Antibodies
HUMHOXY1, KMT8, KMT8A, MTB-ZF, RIZ, RIZ1, RIZ2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005809
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005809, RRID:AB_1079673
Product name
Anti-PRDM2
Provider product page
Atlas Antibodies - HPA005809
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIR
CTKCGKGVDNMPELHKHILACASASDKKRYTPKKN
PVPLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLN
FSVELSKMSSNKLKLNALKKKNQLVQKAI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -