HPA023249

EFCAB13 antibody from Sigma-Aldrich
C17orf57, FLJ40342
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023249
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023249, RRID:AB_1845595
Product name
Anti-C17orf57 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023249
Antibody type
Polyclonal
Antigen
EF-hand domain-containing protein C17orf57 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGGRVSTDDVFAVLDSMGIPINREILEEVTKHTYI
DSNHMVDIGDIIFTLNELQEQYEDVSITEGSPLNE
ITSDRKLSSVAGCYLKYKK
Storage
-20C
Provider Type Product Number
- No reagents -