HPA015475

NOX4 antibody from Sigma-Aldrich
KOX, KOX-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015475
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015475, RRID:AB_1854574
Product name
Anti-NOX4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015475
Antibody type
Polyclonal
Antigen
NADPH oxidase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEF
TQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCA
ERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENF
KARPGQYI
Storage
-20C
Provider Type Product Number
- No reagents -