Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA015475 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA015475, RRID:AB_1854574
- Product name
- Anti-NOX4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEF
TQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCA
ERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENF
KARPGQYI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Nicotinamide Adenine Dinucleotide Phosphate Oxidase Is Differentially Regulated in Normal Myometrium Versus Leiomyoma
Nicotinamide Adenine Dinucleotide Phosphate Oxidase Expression Is Differentially Regulated to Favor a Pro-oxidant State That Contributes to Postoperative Adhesion Development
Genome-wide methylation profiling identifies an essential role of reactive oxygen species in pediatric glioblastoma multiforme and validates a methylome specific for H3 histone family 3A with absence of G-CIMP/isocitrate dehydrogenase 1 mutation
Modulation of redox signaling promotes apoptosis in epithelial ovarian cancer cells
Fletcher N, Saed M, Abuanzeh S, Abu-Soud H, Al-Hendy A, Diamond M, Saed G
Reproductive Sciences 2014;21(9):1145-1152
Reproductive Sciences 2014;21(9):1145-1152
Nicotinamide Adenine Dinucleotide Phosphate Oxidase Expression Is Differentially Regulated to Favor a Pro-oxidant State That Contributes to Postoperative Adhesion Development
Fletcher N, Abuanzeh S, Saed M, Diamond M, Abu-Soud H, Saed G
Reproductive Sciences 2014;21(8):1050-1059
Reproductive Sciences 2014;21(8):1050-1059
Genome-wide methylation profiling identifies an essential role of reactive oxygen species in pediatric glioblastoma multiforme and validates a methylome specific for H3 histone family 3A with absence of G-CIMP/isocitrate dehydrogenase 1 mutation
Jha P, Pia Patric I, Shukla S, Pathak P, Pal J, Sharma V, Thinagararanjan S, Santosh V, Suri V, Sharma M, Arivazhagan A, Suri A, Gupta D, Somasundaram K, Sarkar C
Neuro-Oncology 2014;16(12):1607-1617
Neuro-Oncology 2014;16(12):1607-1617
Modulation of redox signaling promotes apoptosis in epithelial ovarian cancer cells
Jiang Z, Fletcher N, Ali-Fehmi R, Diamond M, Abu-Soud H, Munkarah A, Saed G
Gynecologic Oncology 2011;122(2):418-423
Gynecologic Oncology 2011;122(2):418-423
No comments: Submit comment
No validations: Submit validation data