Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008458-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008458-M06, RRID:AB_714901
- Product name
- TTF2 monoclonal antibody (M06), clone 1E8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TTF2.
- Antigen sequence
EEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADT
CSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKE
YRLFFRCIRSKAEGKRWCGSIPWQDPDSK- Isotype
- IgG
- Antibody clone number
- 1E8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in Y-79 ( Cat # L042V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TTF2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol