HPA070762

TTF2 antibody from Atlas Antibodies
HuF2, ZGRF6

Antibody data

Product number
HPA070762
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA070762, RRID:AB_2686307
Product name
Anti-TTF2
Provider product page
Atlas Antibodies - HPA070762
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSI
PWQDPDSKEHSVSNKSQHASETFHHSSNWLRNPFK
VLDKNQEPALWKQLIKGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -