HPA005776

TTF2 antibody from Sigma-Aldrich
HuF2, ZGRF6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005776
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005776, RRID:AB_1080416
Product name
Anti-TTF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005776
Antibody type
Polyclonal
Antigen
Transcription termination factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PETHSVPAPGGPAAQAAPAAPGLSLGEGREAATSS
DDEEEDDVVFVSSKPGSPLLFDSTLDLETKENLQF
PDRSVQRKVSPASGVSKKVEPSDPVARRVYLTTQL
KQKKSTLASVNIQALPDKGQKLIKQIQELEEVLSG
LT
Storage
-20C
Provider Type Product Number
- No reagents -