ABIN786355

KPNB1 antibody from antibodies-online
IMB1, Impnb, IPO1, IPOB, MGC2155, MGC2156, MGC2157, NTF97

Antibody data

Product number
ABIN786355
Provider
antibodies-online
Product name
anti-Karyopherin (Importin) beta 1 (KPNB1) (N-Term) antibody
Provider product page
antibodies-online - ABIN786355
Antibody type
Polyclonal
Antigen
Other
Reactivity
Human
Host
Rabbit
Antigen sequence
EHMKESTLEAIGYICQDIDPEQLQDKSNEILTAII
QGMRK EEPSNNVKLA
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -