HPA019058

RBM28 antibody from Sigma-Aldrich
FLJ10377
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019058
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019058, RRID:AB_1856118
Product name
Anti-RBM28 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019058
Antibody type
Polyclonal
Antigen
RNA-binding protein 28 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RKLLLSATSGEKGVRIKECRVMRDLKGVHGNMKGQ
SLGYAFAEFQEHEHALKALRLINNNPEIFGPLKRP
IVEFSLEDRRKLKMKELRIQRSLQKMRSKPATGEP
QKGQPEPAKDQQQK
Storage
-20C
Provider Type Product Number
- No reagents -